无菌粉末

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

Human

HEK293

C-6*His

P21781 (C32-T194)

2252  [NCBI]

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

20-28 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

1. The cell proliferation assay using HaCaT cells has an ED₅₀ value of 1.35-10.94 ng/mL.
2. Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED₅₀ this effect is <47 ng/mL, corresponding to a specific activity is >2.13×10⁴ units/mg.

• 
  Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED₅₀ this effect is 33.63 ng/mL, corresponding to a specific activity is 2.9735×10⁴ units/mg.