See All Kinase Enzyme Systems
Recombinant full-length human CDK9 CyclinK proteins were co-expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. CDK9/CyclinK is a member of the cyclin-dependent protein kinase (CDK) family. CDK9 is closely related to cdc28 cdc2 is an important regulator of the cell cycle (1). CDK9 is a component of the multiprotein complex TAK/P-TEFβ. CDK9 can modulate RNA polymerase II-directed transcription by phosphorylating the C-terminal domain of the largest subunit of RNA polymerase II. CDK9 forms a complex with is regulated by its regulatory subunit cyclin T cyclin K. CDK9 also interacts with the HIV-1 Tat protein, which suggests a possible involvement of this protein in AIDS (2).
ADP-Glo™ Kinase Assay is a luminescent kinase assay that measures ADP formed from a kinase reaction; ADP is converted ATP, which is a substrate in a reaction catalyzed by Ultra-Glo™ Luciferase that produces light. The luminescent signal positively correlates with ADP amount kinase activity. The assay is well suited for measuring the effects chemical compounds have on the activity of a broad range of purified kinases, making it ideal for both primary screening as well as kinase selectivity profiling. The ADP-Glo™ Kinase Assay can be used to monitor the activity of virtually any ADP-generating enzyme (e.g., kinase ATPase) using up to 1mM ATP.
Kinase Enzyme System contains:
-
Kinase: CDK9/CyclinK, 10μg (Human, recombinant full-length). MW: ~68kDa (CDK9) ~67kDa (CyclinK).
-
Substrate: PDKtide ([protein fragment, 39 aa]); residues 1–14 are derived from AKT1 (307–320), residues 16–39 are derived from PKN2/PRK2 (961–984).
-
Other: Reaction Buffer, DTT.
CDK9/CyclinK NCBI Database Entry.
Human Kinase Enzyme Systems Applications.
特点 - 优点
-
Profile More Compounds In-House: ADP-Glo™ Kinase Assay + Kinase Enzyme System is optimized so that you are up running in no time.
-
Complete Systems: The Kinase Enzyme Systems include a recombinant kinase enzyme, a substrate appropriate for the enzyme, a reaction buffer, DTT supplemental reagents as needed.
-
Obtain Reliable Results: The broad dynamic range, the ease of use better sensitivity obtained with ADP-Glo™ Kinase Assay result in less ambiguous data.
注意事项
Kinase Enzyme System manufactured by SignalChem.
Bulk quantities available upon request.