See All Kinase Enzyme Systems
Recombinant full-length human PDK1 was expressed by baculovirus in Sf9 insect cells using an N-terminal His tag. PDK1 (3-phosphoinositide-dependent protein kinase) is activated by the presence of PtdIns(3,4,5)P3 PtdIns(3,4)P2. PDK1 then activates protein kinase B (PKB), which in turn, inactivates glycogen synthase kinase-3 (GSK3). The phosphorylation of other proteins by PKB GSK3 is likely to mediate many of the intracellular actions of insulin. Thus, PDK1 plays a key role in mediating many of the actions of the second messenger(s) PtdIns(3,4,5)P3 / PtdIns(3,4)P2. The human PDK1 is a 556-residue monomeric enzyme comprising of a catalytic domain that is most similar to the PKA, PKB PKC subfamily of protein kinases.

ADP-Glo™ Kinase Assay is a luminescent kinase assay that measures ADP formed from a kinase reaction; ADP is converted ATP, which is a substrate in a reaction catalyzed by Ultra-Glo™ Luciferase that produces light. The luminescent signal positively correlates with ADP amount kinase activity. The assay is well suited for measuring the effects chemical compounds have on the activity of a broad range of purified kinases, making it ideal for both primary screening as well as kinase selectivity profiling. The ADP-Glo™ Kinase Assay can be used to monitor the activity of virtually any ADP-generating enzyme (e.g., kinase ATPase) using up to 1mM ATP.

Kinase Enzyme System contains:

• Kinase: PDK1, 10μg (Human, recombinant full-length). MW: ~67kDa.
• Substrate: PDKtide (KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC); derived from two human proteins: residues 1–14 are based on AKT1 (307–320) residues 16–39 are based on PKN2/PRK2 (961–984).
• Other: Reaction Buffer, DTT.

PDK1 NCBI Database Entry.

Human Kinase Enzyme Systems Applications.

特点 - 优点

• Profile More Compounds In-House: ADP-Glo™ Kinase Assay + Kinase Enzyme System is optimized so that you are up running in no time.
• Complete Systems: The Kinase Enzyme Systems include a recombinant kinase enzyme, a substrate appropriate for the enzyme, a reaction buffer, DTT supplemental reagents as needed.
• Obtain Reliable Results: The broad dynamic range, the ease of use better sensitivity obtained with ADP-Glo™ Kinase Assay result in less ambiguous data.

注意事项

Kinase Enzyme System manufactured by SignalChem.
Bulk quantities available upon request.